PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G0016
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 225aa    MW: 26191.1 Da    PI: 8.6379
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G0016genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed++l+d+v+++G+++W++Ia++++ gR++k+ck+rw++ 
      Gh_A11G0016  4 RGHWRPAEDDKLLDLVQRYGPHNWNAIAEKLQ-GRSGKSCKLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding56.18.2e-185699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
      Gh_A11G0016 56 RSPFTEEEEERLLASHRIHGNR-WSVIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.495150IPR017930Myb domain
SMARTSM007171.1E-14352IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-29497IPR009057Homeodomain-like
PfamPF002491.2E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-27557IPR009057Homeodomain-like
CDDcd001673.38E-14748No hitNo description
PROSITE profilePS5129425.11751105IPR017930Myb domain
SMARTSM007172.4E-1555103IPR001005SANT/Myb domain
PfamPF002491.7E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2158104IPR009057Homeodomain-like
CDDcd001676.75E-135898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MCSRGHWRPA EDDKLLDLVQ RYGPHNWNAI AEKLQGRSGK SCKLRWFNQL DPRINRSPFT  60
EEEEERLLAS HRIHGNRWSV IARLFPGRTD NAVKNHWHVI MARRCRRQRS SSKTLPPSTS  120
TSHQPHITST TLFPHNNYMH AFPPYSYFKH FYAHNPNPSL TTTTQAIADT TQPTEFYDFL  180
QVNTDSNESE VTDNTCKRDG EEVDQEHQSR PAVPFFDFLS VPRSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-3311051105C-Myb DNA-Binding Domain
1msf_C2e-3311051105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488370.11e-152PREDICTED: transcriptional activator Myb-like isoform X1
TrEMBLA0A0B0NMG31e-170A0A0B0NMG3_G
STRINGVIT_17s0000g01890.t018e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.13e-81myb domain protein 52